SHILPAMED
SHILPA MEDICARE LTDHealthcare
LTP
759.75
CHG · %
+20.95 (+2.84%)
VOL · TODAY
63.04L
PREV CLOSE
738.8
Today's range731.45 · 773.75
759.75
52-week range259.5 · 773.75
759.75
Loading candles…
Shilpa Medicare, established in 1987 and headquartered in Raichur, Karnataka, operates in the pharmaceutical industry. The company manufactures niche active pharmaceutical ingredients (APIs), intermediates, and formulations. Its product portfolio includes 16 injectable dosage forms and 19 oral solid dosage forms marketed under Shilpa Medicare Limited (SML), along with 13 formulations developed by its wholly owned subsidiary, Shilpa Therapeutics. The business segments encompass APIs, intermediates, formulations, contract research and manufacturing services, oncology, non-oncology, biologics, and emerging specialty areas such as Antibody Drug Conjugates (ADCs). Shilpa Medicare has evolved into a specialist drug delivery entity with a diversified presence in these segments. The company maintains a significant regulatory presence across more than 50 countries, including the United States, the European Union, and various emerging markets.
SHILPAMED is not part of any active scan today.
This page is a live market overview for SHILPA MEDICARE LTD (SHILPAMED) on the NSE. As a listed security, SHILPA MEDICARE LTD is tracked in the Healthcare segment of the Indian cash market and is widely followed for price discovery, liquidity and sector exposure. Use this overview to review price action, session ranges and derivatives context for SHILPAMED before placing trades on tick2trade.
As of the latest feed, SHILPAMED last traded at ₹759.75 on NSE, up ₹20.95 (2.84%) from the previous close of ₹738.8. Today's session range is ₹731.45 – ₹773.75, against a 52-week band of ₹259.5 – ₹773.75. Traded volume today stands at 63.04L shares.
The overview consolidates an interactive price chart with multiple time ranges, recent market headlines, upcoming corporate events for SHILPAMED in one place so you do not need multiple screens during the session. Day and 52-week ranges help you judge whether SHILPAMED is trading near support, resistance or the middle of its recent band. Volume and depth, when available, add context on how aggressively the name is being bought or sold.
Equity overview pages are built for investors who want a single reference for SHILPA MEDICARE LTD before reading news, checking results or sizing a position. Corporate events and headlines in the side column surface catalysts that may explain sudden moves in SHILPAMED. Related stocks in the same sector appear at the bottom of the page for quick peer comparison.
For a full option chain with greeks, open-interest bias, max pain and multi-leg strategy tools, open the tick2trade terminal or visit the dedicated SHILPAMED option chain page linked from this overview.
// similar in healthcare314 total
SUNPHARMADIVISLABTORNTPHARMAPOLLOHOSPCIPLAZYDUSLIFELUPINMAXHEALTHMANKINDLAURUSLABSDRREDDYAUROPHARMAMANIPALHOSFORTISBIOCONALKEMGLENMARKABBOTINDIAANTHEMASTERDM
show more (+294)show less
GLAXOIPCALABAJANTPHARMGLANDMEDANTANHEMCUREKIMSWOCKPHARMALALPATHLABNEULANDLABSAILIFEPPLPHARMAACUTAASRUBICONPFIZERGRANULESASTRAZENCAPLIPOINTERISONESOURCEAGARWALEYEPOLYMEDCOHANCENATCOPHARMALIVUSAPLLTDSYNGENERAINBOWJUBLPHARMACONCORDBIOVIJAYAINDGNPARKHOSPSCORONAMARKSANSVIYASHMETROPOLISBLUEJETAKUMSJLHLSANOFICONRPGHLHCGTHYROCARESTARSUVENYATHARTHSANOFISUPRIYANEPHROPLUSSPARCKOVAIAARTIPHARMSENORESFDCINNOVACAPORCHPHARMABLISSGVSARTEMISMEDIOLCPZOTARPGLIFEMOREPENLABGUFICBIONOVARTINDGUJTHEMAARTIDRUGSADVENZYMESSMSPHARMAINDRAMEDCOUNICHEMLABDCALVIMTALABSHIKALKPLDRAGARWQPANACEABIOSAIPARENTFISCHERBETASOLARANGLFINEVENUSREMFREDUNSAKARHESTERBIOINDOCOINDSWFTLABKMCSHILWINDLASKRSNAASHALBYSHUKRAPHARTARSONSFERMENTAJAGSNPHARMAMRUTANJANGPTHEALTHSURAKSHASYNCOMFQLINEUNIHEALTHLINCOLNLAXMIDENTLBAJAJHCAREONEGLOBALGKSL3BBLACKBIOTHEMISMEDREMUSHEALTHXSIGACHIGAUDIUMIVFBPLPHARMAWANBURYKOPRANANUHPHRSGRLAHCLOSELDEVICEDENTALKARTKILITCHBAFNAPHFABTECHINFLUXAMANTAKRMAYURVEDZIMLABCHANDANAPPLALBERTDAVDJENBURPHHALEOSLABSMEDICOCCMETRANSCHEMAMBALALSAVALIANTLABASTALLTDINFINIUMTAKEBDHNURECAMEDICAMEQTLLEVERESTOASTONEALABZENOTECHAPRAMEYALOTUSEYELYKALABSSANJIVINAAREYDRUGSQMSMEDIGENNEXCORALABNECLIFEACCPLMADHAVBAUGOXYGENTAPHKERALAYUREARKARTSATKARTARBMLLBROOKSACHYUTNOVELIXJSTLSYSCHEMNATCAPSUQPARNAXLABGUJINJECABATEASPANCHSHEELBIQUESTLABAUROLABALPASTARIMAGINBALPHARMAKIMIABLCHOKSIAVIENCEBALAXISMRUTHIORGLACTOSETYCHENEPHROCAREPHARMAIDPARKREBSBIOASPIRAGODAVARIVAISHALISOTACMERCURYLABINVICTADENISCHEMCONCORDMAKERSLFORTISMLRJFLLIFEVEERHEALTHCURISMAITREYAAMWILLCHOKSILAONYXMDRCSAMRATPHZENITHDRUGSUNLOCSOURCENTRLVINEETLABBIBCLVILINBIOMHHLSANGANISHANMUGAROYALKABRADGVRLPHRMASISHREEPACBIOFILCHEMVIVOBIOTSHELTERKMSMEDIMANGALAMANGAATMAJRAJNISHVIVIMEDLABGLPLLASAROOPAINDVISTAPHPARMAXNGINDSANDUPHQBANDARAMSUNRESTGUJTERCSHARMEHWALPARMEDICAPQSMLMEDIORGCSURGSUWELCUREDECCANGKBCMMHOSPTEJNAKSHSAMSRITAGMLBACPHARCHCLADESHWARSDLCENTUPLEISHITADRSHREEGANESCOLINZVENMAXTRABINIDANVINRKLBZENITHHEDESHRAKFAMILYCAREMONOPHARMAGLHRLDPLORTINGLOBEBERLDRGSTARSOURCEUNJHAFORLOOKSZDHJERKGVBLCTLLABADLINEVIVANZADECIPHERDLCLBRAWNASHRAMGIANLIFETRANSPACTSHYAMACOMPBOSTONTRIPR
Frequently asked questions
- What is the current price of SHILPAMED?
- SHILPAMED last traded at ₹759.75 on NSE. The previous close was ₹738.8. Prices refresh throughout market hours on this overview page.
- What is today's trading range for SHILPAMED?
- The session low is ₹731.45 and the session high is ₹773.75. The 52-week range spans ₹259.5 to ₹773.75, giving longer-term context for today's move.
- Where can I see the SHILPAMED option chain?
- A mini option chain appears in the right column when derivatives data is available. For the full chain with greeks, max pain and PCR, visit the dedicated SHILPAMED option chain page or open tick2trade.
- What data is shown on the SHILPA MEDICARE LTD overview page?
- The page includes live LTP, day and 52-week ranges, traded volume, an interactive price chart, market depth, recent news, corporate events and related stocks in the same sector.
- Which sector is SHILPA MEDICARE LTD in?
- SHILPA MEDICARE LTD is tracked in the Healthcare segment on NSE. Use the related-stocks section at the bottom of this page to compare peers in the same industry cluster.
- Is tick2trade free to use for SHILPAMED quotes?
- Yes — this overview page is free to access. Live prices, charts and the panels on this page do not require a login. Advanced execution, strategy building and full-depth analytics are available in the tick2trade terminal.