INDGN
INDEGENE LIMITEDHealthcare
LTP
554.45
CHG · %
+4.25 (+0.77%)
VOL · TODAY
9.63L
PREV CLOSE
550.2
Today's range546.1 · 561.9
554.45
52-week range414 · 596.8
554.45
Loading candles…
Indegene Ltd, incorporated in 1998, operates globally providing services to the life sciences, healthcare, biopharmaceutical, biotech, and medical devices industries. The company offers a range of solutions across several business segments, including analytics, technology, commercial services, medical services, regulatory services, safety services, and digitally-led commercialization services. Its products and services encompass analytics and technology solutions, commercial and medical services, regulatory affairs, pharmacovigilance, sales and marketing services, and clinical trials support. Indegene delivers these services by integrating healthcare domain expertise with technology, leveraging proprietary platforms and a workforce with strong clinical and medical backgrounds to provide outcomes-based solutions across clinical trials, regulatory affairs, medical affairs, pharmacovigilance, and sales and marketing within the global life sciences sector.
This page is a live market overview for INDEGENE LIMITED (INDGN) on the NSE. As a listed security, INDEGENE LIMITED is tracked in the Healthcare segment of the Indian cash market and is widely followed for price discovery, liquidity and sector exposure. Use this overview to review price action, session ranges and derivatives context for INDGN before placing trades on tick2trade.
As of the latest feed, INDGN last traded at ₹554.45 on NSE, up ₹4.25 (0.77%) from the previous close of ₹550.2. Today's session range is ₹546.1 – ₹561.9, against a 52-week band of ₹414 – ₹596.8. Traded volume today stands at 9.63L shares.
The overview consolidates an interactive price chart with multiple time ranges, recent market headlines, upcoming corporate events for INDGN in one place so you do not need multiple screens during the session. Day and 52-week ranges help you judge whether INDGN is trading near support, resistance or the middle of its recent band. Volume and depth, when available, add context on how aggressively the name is being bought or sold.
Equity overview pages are built for investors who want a single reference for INDEGENE LIMITED before reading news, checking results or sizing a position. Corporate events and headlines in the side column surface catalysts that may explain sudden moves in INDGN. Related stocks in the same sector appear at the bottom of the page for quick peer comparison.
For a full option chain with greeks, open-interest bias, max pain and multi-leg strategy tools, open the tick2trade terminal or visit the dedicated INDGN option chain page linked from this overview.
// similar in healthcare314 total
SUNPHARMADIVISLABTORNTPHARMAPOLLOHOSPCIPLAZYDUSLIFELUPINMAXHEALTHMANKINDLAURUSLABSDRREDDYAUROPHARMAMANIPALHOSFORTISBIOCONALKEMGLENMARKABBOTINDIAANTHEMASTERDM
show more (+294)show less
GLAXOIPCALABAJANTPHARMGLANDMEDANTANHEMCUREKIMSWOCKPHARMALALPATHLABNEULANDLABSAILIFEPPLPHARMAACUTAASRUBICONPFIZERGRANULESASTRAZENCAPLIPOINTERISONESOURCEAGARWALEYEPOLYMEDCOHANCENATCOPHARMALIVUSAPLLTDSYNGENERAINBOWSHILPAMEDJUBLPHARMACONCORDBIOVIJAYAPARKHOSPSCORONAMARKSANSVIYASHMETROPOLISBLUEJETAKUMSJLHLSANOFICONRPGHLHCGTHYROCARESTARSUVENYATHARTHSANOFISUPRIYANEPHROPLUSSPARCKOVAIAARTIPHARMSENORESFDCINNOVACAPORCHPHARMABLISSGVSARTEMISMEDIOLCPZOTARPGLIFEMOREPENLABGUFICBIONOVARTINDGUJTHEMAARTIDRUGSADVENZYMESSMSPHARMAINDRAMEDCOUNICHEMLABDCALVIMTALABSHIKALKPLDRAGARWQPANACEABIOSAIPARENTFISCHERBETASOLARANGLFINEVENUSREMFREDUNSAKARHESTERBIOINDOCOINDSWFTLABKMCSHILWINDLASKRSNAASHALBYSHUKRAPHARTARSONSFERMENTAJAGSNPHARMAMRUTANJANGPTHEALTHSURAKSHASYNCOMFQLINEUNIHEALTHLINCOLNLAXMIDENTLBAJAJHCAREONEGLOBALGKSL3BBLACKBIOTHEMISMEDREMUSHEALTHXSIGACHIGAUDIUMIVFBPLPHARMAWANBURYKOPRANANUHPHRSGRLAHCLOSELDEVICEDENTALKARTKILITCHBAFNAPHFABTECHINFLUXAMANTAKRMAYURVEDZIMLABCHANDANAPPLALBERTDAVDJENBURPHHALEOSLABSMEDICOCCMETRANSCHEMAMBALALSAVALIANTLABASTALLTDINFINIUMTAKEBDHNURECAMEDICAMEQTLLEVERESTOASTONEALABZENOTECHAPRAMEYALOTUSEYELYKALABSSANJIVINAAREYDRUGSQMSMEDIGENNEXCORALABNECLIFEACCPLMADHAVBAUGOXYGENTAPHKERALAYUREARKARTSATKARTARBMLLBROOKSACHYUTNOVELIXJSTLSYSCHEMNATCAPSUQPARNAXLABGUJINJECABATEASPANCHSHEELBIQUESTLABAUROLABALPASTARIMAGINBALPHARMAKIMIABLCHOKSIAVIENCEBALAXISMRUTHIORGLACTOSETYCHENEPHROCAREPHARMAIDPARKREBSBIOASPIRAGODAVARIVAISHALISOTACMERCURYLABINVICTADENISCHEMCONCORDMAKERSLFORTISMLRJFLLIFEVEERHEALTHCURISMAITREYAAMWILLCHOKSILAONYXMDRCSAMRATPHZENITHDRUGSUNLOCSOURCENTRLVINEETLABBIBCLVILINBIOMHHLSANGANISHANMUGAROYALKABRADGVRLPHRMASISHREEPACBIOFILCHEMVIVOBIOTSHELTERKMSMEDIMANGALAMANGAATMAJRAJNISHVIVIMEDLABGLPLLASAROOPAINDVISTAPHPARMAXNGINDSANDUPHQBANDARAMSUNRESTGUJTERCSHARMEHWALPARMEDICAPQSMLMEDIORGCSURGSUWELCUREDECCANGKBCMMHOSPTEJNAKSHSAMSRITAGMLBACPHARCHCLADESHWARSDLCENTUPLEISHITADRSHREEGANESCOLINZVENMAXTRABINIDANVINRKLBZENITHHEDESHRAKFAMILYCAREMONOPHARMAGLHRLDPLORTINGLOBEBERLDRGSTARSOURCEUNJHAFORLOOKSZDHJERKGVBLCTLLABADLINEVIVANZADECIPHERDLCLBRAWNASHRAMGIANLIFETRANSPACTSHYAMACOMPBOSTONTRIPR
Frequently asked questions
- What is the current price of INDGN?
- INDGN last traded at ₹554.45 on NSE. The previous close was ₹550.2. Prices refresh throughout market hours on this overview page.
- What is today's trading range for INDGN?
- The session low is ₹546.1 and the session high is ₹561.9. The 52-week range spans ₹414 to ₹596.8, giving longer-term context for today's move.
- Where can I see the INDGN option chain?
- A mini option chain appears in the right column when derivatives data is available. For the full chain with greeks, max pain and PCR, visit the dedicated INDGN option chain page or open tick2trade.
- What data is shown on the INDEGENE LIMITED overview page?
- The page includes live LTP, day and 52-week ranges, traded volume, an interactive price chart, market depth, recent news, corporate events and related stocks in the same sector.
- Which sector is INDEGENE LIMITED in?
- INDEGENE LIMITED is tracked in the Healthcare segment on NSE. Use the related-stocks section at the bottom of this page to compare peers in the same industry cluster.
- Is tick2trade free to use for INDGN quotes?
- Yes — this overview page is free to access. Live prices, charts and the panels on this page do not require a login. Advanced execution, strategy building and full-depth analytics are available in the tick2trade terminal.