BLS
BLS INTL SERVS LTDConsumer Services
LTP
241
CHG · %
+0.85 (+0.35%)
VOL · TODAY
6.47L
PREV CLOSE
240.15
Today's range237 · 241.25
241
52-week range218.9 · 374
241
Loading candles…
BLS International Services Limited operates as a global technology-enabled services provider for governments and diplomatic missions, specializing in visa, passport, consular, and citizen services. The company handles administrative and non-discretionary tasks associated with these services, allowing client governments to concentrate on decision-making. It functions primarily in the visa application outsourcing, passport and consular services, and digital services industries. BLS International serves more than 46 client governments across over 70 countries and is recognized as the largest global player in visa application outsourcing and the second-largest in the visa, passport, consular, and citizen services domain. The company is part of the BLS Group, which has been operational for four decades and offers a diversified range of services.
BLS is not part of any active scan today.
This page is a live market overview for BLS INTL SERVS LTD (BLS) on the NSE. As a listed security, BLS INTL SERVS LTD is tracked in the Consumer Services segment of the Indian cash market and is widely followed for price discovery, liquidity and sector exposure. Use this overview to review price action, session ranges and derivatives context for BLS before placing trades on tick2trade.
As of the latest feed, BLS last traded at ₹241 on NSE, up ₹0.85 (0.35%) from the previous close of ₹240.15. Today's session range is ₹237 – ₹241.25, against a 52-week band of ₹218.9 – ₹374. Traded volume today stands at 6.47L shares.
The overview consolidates an interactive price chart with multiple time ranges, five-level bid and ask depth, recent market headlines, upcoming corporate events for BLS in one place so you do not need multiple screens during the session. Day and 52-week ranges help you judge whether BLS is trading near support, resistance or the middle of its recent band. Volume and depth, when available, add context on how aggressively the name is being bought or sold.
Equity overview pages are built for investors who want a single reference for BLS INTL SERVS LTD before reading news, checking results or sizing a position. Corporate events and headlines in the side column surface catalysts that may explain sudden moves in BLS. Related stocks in the same sector appear at the bottom of the page for quick peer comparison.
For a full option chain with greeks, open-interest bias, max pain and multi-leg strategy tools, open the tick2trade terminal or visit the dedicated BLS option chain page linked from this overview.
// similar in consumer services235 total
ETERNALDMARTTRENTLENSKARTINDHOTELMEESHONYKAANAUKRISWIGGYVMMIRCTCPWLITCHOTELSJUBLFOODURBANCOCHALETTHELEELATBOTEKEIHOTELDEVYANI
show more (+215)show less
TRAVELFOODMANYAVARCARTRADEVENTIVEABLBLINDIAMARTFIRSTCRYLEMONTREEWESTLIFEMEDPLUSENTEROV2RETAILAVLCORDELIASAPPHIREIXIGORBAEMILVMARTABFRLJSLLSISARVINDFASNJUSTDIALITDCTHOMASCOOKJUNIPERSHOPERSTOPMHRILRTNINDIASAMHIWONDERLASEILIMAGICAANIITMTSSTYLEBAAZACRIZACUFBLORIENTHOTPARKHOTELSEASEMYTRIPVERANDABRIGHOTELTAJGVKEIHAHOTELSSPICELOUNGYATRAGOCOLORSASIANHOTNRDELTACORPVHLTDNIITLTDKALAMANDIRBENARASMATRIMONYTCCJAROVINSYSMCCHRLSBROHLTDUPHOTPATELRMARTADVENTHTLPRAVEGCOFFEEDAYEXHICONSPECIALITYKAMATHOTELAHLWESTGLOBALSAYAJIHOTLKAYAAPTECHTMUFTIADVANIHOTRBHATIAEMERALLEBIXSINCLAIRHLVLTDSHILINDORENICCOPARVPALSHANKARACPEDUMACHLTDAPOLSINHOTCLEDUCATEARIHANTACARHLSSPRLKDMLSPENCERSSHPLPUNEMKEXIMGCHOTELSMAGSONSUBAHOTELSESPIREAHLEASTZEELEARNACETECITHLEFACTORBCONCEPTSGRAVISSHOCCHHLONDOORSAVERADUGLOBALFWSTCGOLDENCRESTBYKEGOURMETHBGHOTELSCHLLTDTRADWINACEMENKORELLOYDSVJTFEDUISFTCPMLVIJAYPDCITYSQUAREMTLMRPCOMPUSOFTFONEBOXPARTYCRUSMOXSHNISMGMTWOMANCARTPRAXISSAFEUMLIRONWOODDRONEJETKINGQASCENSIVEGUJHOTETOUCHWOODADDICTIVEDIGIDRIVEKAMATSMOPSHOPLCCINFOTECTSCSAJHOTELSBIRDYSRAYALEMAECOHOTELSROOPSHRIJINDHOTACMLKLLBLUECOASTHELLOJIOSIAHYPERTAVEXIAYAANENTJUPITERINVMOBILELGTCELLPOINTGTECJAINXKAUSHALYAKEEPLEARNRELIABVENTGBHOTELSVKALBESTEASTTREEHOUSEVIRTUALGFLFLARUNAHTELNHLVALINDIAAHASOLARAJWAFUNLGLLUHMVLRASRESORHAVISHATHESL7NRCINDHOHOWARHOVELHOTRAVELSHOTLSILVASRLFELOLYMPTXRETAILWOSALUMESLTDMTEDUCARELORDSHOTLASIANFONE4DHTLCBAZAARSTRGRENWOFELDVRKGESWINNYSAILANIFTLSILVERPRLRCLKHYATIMAFIAJSHLVHLTDRE1
Frequently asked questions
- What is the current price of BLS?
- BLS last traded at ₹241 on NSE. The previous close was ₹240.15. Prices refresh throughout market hours on this overview page.
- What is today's trading range for BLS?
- The session low is ₹237 and the session high is ₹241.25. The 52-week range spans ₹218.9 to ₹374, giving longer-term context for today's move.
- Where can I see the BLS option chain?
- A mini option chain appears in the right column when derivatives data is available. For the full chain with greeks, max pain and PCR, visit the dedicated BLS option chain page or open tick2trade.
- What data is shown on the BLS INTL SERVS LTD overview page?
- The page includes live LTP, day and 52-week ranges, traded volume, an interactive price chart, market depth, recent news, corporate events and related stocks in the same sector.
- Which sector is BLS INTL SERVS LTD in?
- BLS INTL SERVS LTD is tracked in the Consumer Services segment on NSE. Use the related-stocks section at the bottom of this page to compare peers in the same industry cluster.
- Is tick2trade free to use for BLS quotes?
- Yes — this overview page is free to access. Live prices, charts and the panels on this page do not require a login. Advanced execution, strategy building and full-depth analytics are available in the tick2trade terminal.